Product Specification| Species | Mouse | | Antigen | MOG | | Synonyms | BTN6, BTNL11, MOGIG2, NRCLP7, Myelin oligodendrocyte glycoprotein | | Accession | Q61885 | | Amino Acid Sequence | Gly29-Gly153,
with C-terminal 8*His GQFRVIGPGYPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKETISEGKVTLRIQNVRFSDEGGYTCFFRDHSYQEEAAMELKVEDPFYWVNPGGGGSHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | 19-22kDa (Reducing) | | Purity | >95% by SDS-PAGE | | Endotoxin | <0.1EU/μg | | Conjugation | Unconjugated | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4 | | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles. | | Reference | 1. Reindl, M. et al. (2013) Nat. Rev.Neurol. 9:455.
|
BackgroundMyelin
oligodendrocyte glycoprotein (MOG) is a transmembrane protein belonging to
immunoglobulin superfamily. Mouse MOG is
synthesized with a 28 amino acid (aa) signal sequence, a 128 aa extracellular
domain (ECD) containing an Ig-like domain, a 21 aa transmembrane domain, and a
69 aa cytosolic fragment featuring a hydrophobic domain that associates with
the cytoplasmic face of the plasma membrane. MOG is expressed exclusively by
oligodendrocytes in the central nervous system (CNS) and is localized to the outer
layer of the myelin sheath as well as in the oligodendrocyte plasma membrane.
This makes MOG a potential target of cellular and humoral immune responses in
inflammatory demyelinating diseases. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|