Login    Join free Add to favorites    中文
Home >Products> Reagents >Other Reagents> Galectin-9 His Tag Protein, Human
Galectin-9 His Tag Protein, Human
Galectin-9 His Tag Protein, Human
Origin of place Singapore
Model UA010431-100μg
Supplier ANT BIO PTE.LTD.
Price 642
Hits 73
Updated 12/2/2025
  • Product Detail
  • Company Profile

Product Specification


SpeciesHuman
AntigenGalectin-9
SynonymsGal-9, Ecalectin, Tumor antigen HOM-HD-21
AccessionO00182-2
Amino Acid Sequence

Ala2-Thr323, with N-terminal 8* His

HHHHHHHHAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT

Expression SystemHEK293
Molecular Weight

47-55kDa (Reducing)

Purity

>95% by SDS-PAGE

Endotoxin<0.1EU/μg
ConjugationUnconjugated
TagHis Tag
Physical AppearanceLyophilized Powder
Storage BufferPBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Iwasaki-Hozumi H., Chagan-Yasutan H., Ashino Y., Hattori T. Blood Levelsof Galectin-9, an Immuno-Regulating Molecule, Reflect the Severity for theAcute and Chronic Infectious Diseases. Biomolecules. 2021;11:430.

2.Nishi N., Itoh A., Fujiyama A., Yoshida N., Araya S.-i., Hirashima M.,Shoji H., Nakamura T. Development of highly stable galectins: Truncation of thelinker peptide confers protease-resistance on tandem-repeat type galectins.FEBS Lett. 2005;579:2058–2064.

3.Oomizu S., Arikawa T., Niki T., Kadowaki T., Ueno M., Nishi N., Yamauchi A., HirashimaM. Galectin-9 suppresses Th17 cell development in an IL-2-dependent butTim-3-independent manner. Clin. Immunol. 2012;143:51–58. d

4.Bozorgmehr N., Mashhouri S., Perez Rosero E., Xu L., Shahbaz S., Sligl W.,Osman M., Kutsogiannis D.J., MacIntyre E., O’Neil C.R., et al. Galectin-9, aPlayer in Cytokine Release Syndrome and a Surrogate Diagnostic Biomarker inSARS-CoV-2 Infection. mBio. 2021;12:e00384-21.


Background

Galectin-9 is a β-galactoside binding lectin known for its immunomodulatory role in various microbial infections. Gal-9 is expressed in all organ systems and localized in the nucleus, cell surface, cytoplasm and the extracellular matrix. Gal-9 structurally consists of two homologous carbohydrate-recognition domains at the N- and C-terminus (NCRD and CCRD, respectively) linked by a linker peptide that is highly susceptible to proteolysis. It mediates host-pathogen interactions and regulates cell signalling via binding to its receptors. Gal-9 is involved in many physiological functions such as cell growth, differentiation, adhesion, communication and death. Gal-9 is a molecule that positively and negatively adjusts immune systems as both a contributing factor in cytokine storm and an immunosuppressive molecule inducing, for instance, T-cell exhaustion and apoptosis.


bio-equip.cn
Request Infomation

* Name:
Title:
* Tel:
Fax:
* E-mail:
Postcode:
Institution/Company:
Address:
* Country:
Request infomation:
yes no
Request Quotation:
yes no
* Message:
Validated Code:
refresh
I agree to share my inquiry to the other matching suppliers.



Recently viewed products
Copyright(C) 2006-2026 Bio-Equip    E-mail:web@bio-equip.cn   沪ICP备06040519号