Product Specification| Species | Human | | Antigen | IL-6R alpha/CD126 | | Synonyms | IL-6 receptor subunit alpha, IL-6R subunit alpha, IL-6R-alpha, IL-6RA | | Accession | P08887 | | Amino Acid Sequence | Leu20 - Pro365, with C-terminal Human IgG1 Fc LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK | | Expression System | HEK293 | | Molecular Weight | 76-93 kDa (Reducing) | | Purity | >95% by SDS-PAGE | | Endotoxin | <0.1EU/μg | | Conjugation | Unconjugated | | Tag | Human Fc Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4 | | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
| | Reference |
1.M Hibi, M Murakami, M Saito, T Hirano, T Taga, TKishimoto. Molecular cloning and expression of an IL-6 signal transducer,gp130.Cell. 1990 Dec 21;63(6):1149-57.
2. Bin S, Xin L, Lin Z, Jinhua Z, Rui G, Xiang Z.Targeting miR-10a-5p/IL-6Raxis for reducing IL-6-induced cartilage cell ferroptosis.Exp Mol Pathol. 2021Feb;118:104570. Cell., 63 (1990), pp. 1149-1157. |
BackgroundThe
Interleukin-6 receptor (IL-6R) consists of an 80-kDa IL-6 binding protein (α
chain) (CD126) and gp130. The alpha-chain CD126 is a glycoprotein that contains
the ligand-binding site. The human IL-6R protein contains 468 amino acids,
which includes a signal peptide, an extracellular region, a transmembrane
domain, and a short cytoplasmic domain of 19, 339, 28, and 82 amino acids,
respectively. IL-6R are present on several types of tumor cells, including
multiple myeloma, hepatocellular carcinoma, prostate carcinoma , and epidermoid
carcinoma. The IL-6/IL-6R signal pathway promotes the tumor growth in various
cancers, especially for glioma. Hence, IL-6R not only can be used as a target
site for transporting drugs, but also as a therapeutic site. Primary human
cartilage cells express IL-6R, which is further induced in the presence of
IL-6. This makes cartilage cells direct targets or effectors of IL-6. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|