IL-6R alpha/CD126 Fc Chimera Protein, Human,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Antigen	IL-6R alpha/CD126
Synonyms	IL-6 receptor subunit alpha, IL-6R subunit alpha, IL-6R-alpha, IL-6RA
Accession	P08887
Amino Acid Sequence	Leu20 - Pro365, with C-terminal Human IgG1 Fc LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Expression System	HEK293
Molecular Weight	76-93 kDa (Reducing)
Purity	＞95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	Human Fc Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1.M Hibi, M Murakami, M Saito, T Hirano, T Taga, TKishimoto. Molecular cloning and expression of an IL-6 signal transducer,gp130.Cell. 1990 Dec 21;63(6):1149-57. 2. Bin S, Xin L, Lin Z, Jinhua Z, Rui G, Xiang Z.Targeting miR-10a-5p/IL-6Raxis for reducing IL-6-induced cartilage cell ferroptosis.Exp Mol Pathol. 2021Feb;118:104570. Cell., 63 (1990), pp. 1149-1157.

Background

The Interleukin-6 receptor (IL-6R) consists of an 80-kDa IL-6 binding protein (α chain) (CD126) and gp130. The alpha-chain CD126 is a glycoprotein that contains the ligand-binding site. The human IL-6R protein contains 468 amino acids, which includes a signal peptide, an extracellular region, a transmembrane domain, and a short cytoplasmic domain of 19, 339, 28, and 82 amino acids, respectively. IL-6R are present on several types of tumor cells, including multiple myeloma, hepatocellular carcinoma, prostate carcinoma , and epidermoid carcinoma. The IL-6/IL-6R signal pathway promotes the tumor growth in various cancers, especially for glioma. Hence, IL-6R not only can be used as a target site for transporting drugs, but also as a therapeutic site. Primary human cartilage cells express IL-6R, which is further induced in the presence of IL-6. This makes cartilage cells direct targets or effectors of IL-6.