COL6A3 His Tag Protein, Human,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	COL6A3, collagen, type VI, alpha 3
Accession	P12111
Amino Acid Sequence	Thr3101-Thr3177, with N-terminal 8*His HHHHHHHHTEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMGT
Expression System	HEK293
Molecular Weight	11-13kDa
Purity	>95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1、Kim, Gloria B et al. (2022) Quantitative immunopeptidomics reveals a tumor stroma-specific target for T cell therapy. Science translational medicine. 14: 660.

Background

Mutations in the genes COL6A1, COL6A2, and COL6A3, coding for three α chains of collagen type VI, underlie a spectrum of myopathies. The COL6A3 gene provides instructions for making one component of type VI collagen, which is a flexible protein found in the space that surrounds cells. The COL6A3 protein is a component of type VI collagen and is present in connective tissues throughout the body, but exon 6 is only expressed in stromal cells in the tumor microenvironment. Collagen is found in the extracellular matrix, which is necessary for cell stability and growth. Research suggests that type VI collagen links basement membranes, which are thin, sheet-like structures that are part of the extracellular matrix, to nearby cells.