Login    Join free Add to favorites    中文
Home >Products> Reagents >Other Reagents> Biotinylated BCMA Fc&Avi Tag Protein, Human
Biotinylated BCMA Fc&Avi Tag Protein, Human
Biotinylated BCMA Fc&Avi Tag Protein, Human
Origin of place Singapore
Model UA010461-25μg
Supplier ANT BIO PTE.LTD.
Price 512
Hits 29
Updated 12/2/2025
  • Product Detail
  • Company Profile

Product Specification


SpeciesHuman
AntigenBCMA
SynonymsTNFRSF17, CD269, BCM, BCMA
AccessionQ02223-1
Amino Acid Sequence

Met1-Ala54, with C-terminal Human IgG1 Fc &Avi tag

MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE


Expression SystemHEK293
Molecular Weight

38-45kDa (Reducing)

Purity>95% by SDS-PAGE
Endotoxin<0.1EU/μg
ConjugationBiotin
TagHuman Fc Tag, Avi Tag
Physical AppearanceLyophilized Powder
Storage BufferPBS, pH7.4
ReconstitutionReconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Nina Shah, Ajai Chari, Emma Scott, Khalid Mezzi& Saad Z. Usmani: B-cell maturation antigen (BCMA) in multiple myeloma:rationale for targeting and current therapeutic approaches, Leukemia volume 34, pages985–1005 (2020).


Background

BCMA (The B-cell maturation antigen), also designated as TNFRSF17, belongs to the tumor necrosis factor receptor superfamily, which is a family of cytokine receptors. BCMA is encoded by a 2.92-kb TNFRSF17 gene located on the short arm of chromosome 16 (16p13.13) and composed of 3 exons separated by 2 introns. There are four natural splice variants of human BCMA that present with different receptor binding affinities, membrane-anchoring ability, and intracellular domain signaling. BCMA main ligands are the cytokines B-cell activating factor and a proliferation-inducing ligand. The interaction between BCMA and its ligands activates the NF-κB signaling pathway that plays an important role in B-cell proliferation and maturation and is essential for the survival of long-lived bone marrow plasma cells. BCMA is expressed preferentially on mature B cells and has minimal expression on hematopoietic stem cells or other cell types. The BCMA has emerged as a central target in multiple myeloma (MM). In preclinical studies, overexpression of BCMA and the interaction with is ligand, a proliferation-inducing ligand (APRIL), was found to promote MM progression in vivo and augment MM cell growth and survival through induction of multiple signaling cascades, including protein kinase B (AKT), MAPK, and nuclear factor (NF)-κB. Additionally, BCMA has been shown to be solubilized at high levels in serum of patients with MM (sBCMA). This form of sBCMA binds to B-cell activating factor (BAFF). The role of BAFF is to stimulate normal B-cell and plasma cell development; however, this functioning is prevented when it is bound by BCMA in the serum, thereby leading to decreased polyclonal immunoglobulin levels in patients with MM.


bio-equip.cn
Request Infomation

* Name:
Title:
* Tel:
Fax:
* E-mail:
Postcode:
Institution/Company:
Address:
* Country:
Request infomation:
yes no
Request Quotation:
yes no
* Message:
Validated Code:
refresh
I agree to share my inquiry to the other matching suppliers.



Copyright(C) 2006-2025 Bio-Equip    E-mail:web@bio-equip.cn   沪ICP备06040519号