CD200 His Tag Protein, Mouse,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Mouse
Antigen	CD200
Synonyms	My033，CD200 Antigen，Antigen Identified By Monoclonal Antibody MRC OX-2，MOX1，OX-2 Membrane Glycoprotein，OX-2，MRC，CD200 Molecule，MOX2
Accession	O54901
Amino Acid Sequence	Gln31-Gly232, with C-terminal 8*His QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKGGGGSHHHHHHHH
Expression System	HEK293
Molecular Weight	35-50kDa (Reducing)
Purity	＞95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1.Barclay A.N., Wright G.J., Brooke G., Brown M.H.CD200 and membrane protein interactions in the control of myeloid cells. TrendsImmunol. 2002;23:285–290. 2.Wright G.J., Puklavec M.J., Willis A.C., HoekR.M., Sedgwick J.D., Brown M.H., Barclay A.N. Lymphoid/Neuronal cell surfaceOX2 glycoprotein recognizes a novel receptor on macrophages implicated in thecontrol of their function. Immunity. 2000;13:233–242. 3.Moreaux J., Veyrune J.L., Reme T., De Vos J.,Klein B. CD200, A putative therapeutic target in cancer. Biochem. Biophys. Res.Commun. 2008;366:117–122. 4.Barclay A.N. Different reticular elements in ratlymphoid tissue identified by localization of IA, Thy-1 and MRC OX-2 antigens.Immunology. 1981;44:727–736.

Background

CD200 is a type-1 cell membrane glycoprotein of the immunoglobulin supergene family, present on both cells with myeloid/lymphoid origin as well as on epithelial cells and many cancer cells. CD200, also known as MRC OX-2, is a highly conserved, 48 kDa type 1a transmembrane glycoprotein related structurally to the B7 family of costimulatory receptors.The molecule itself consists of an IgSF extracellular domain (single V + C), a single transmembrane region and a short cytoplasmic tail lacking signaling motifs. The molecule is expressed by resting dendritic cells, thymocytes, endothelial cells, neurons and osteoblast precursors (OBp), as well as by activated B and T cells (including αβTCR+ and most γδTCR+ cells). CD200 interacts with a structurally related receptor (CD200R) expressed mainly on myeloid cells and is involved in regulation of macrophage and mast cell function. OX-2 / CD200 and CD200R associate via their respective N-terminal Ig-like domains. CD200 also plays an important role in prevention of graft rejection, autoimmune diseases and spontaneous abortion.