Product Specification| Species | Human | | Antigen | IL-7R alpha/CD127 | | Synonyms | Interleukin-7 receptor subunit alpha,Interleukin 7 Receptor Isoform H5-6,CDw127,IL-7R subunit alpha,IL-7RA,IL-7 receptor subunit alpha,CD127 Antigen,IL-7R-Alpha,Interleukin 7 Receptor Alpha Chain,CD127,IL7RA,ILRA,Interleukin-7 Receptor alpha Subunit | | Accession | P16871 | | Amino Acid Sequence | Glu21-Asp239, with C-terminal 8*His ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMDGGGSHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | 43-50kDa (Reducing) | | Purity | >95% by SDS-PAGE | | Endotoxin | <0.1EU/μg | | Conjugation | Unconjugated | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4 | | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
| | Reference | 1.Mazzucchelli, R. and S.K. Durum (2007) Nat. Rev.Immunol. 7:144. 2.Liu, Y.-J. et al. (2007) Annu. Rev. Immunol.25:193. 3.Noguchi, M. et al. (1993) Science 262:1877.
|
BackgroundInterleukin 7
Receptor alpha (IL-7 R alpha ), also known as CD127, is a 75 kDa hematopoietin
receptor superfamily member that plays an important role in lymphocyte
differentiation, proliferation, and survival. IL-7 R alpha associates with the
common gamma chain ( gamma c) to form the functional high affinity IL-7
receptor complex. The gamma c is also a subunit of the receptors for IL-2, -4,
-9, -15, and -21. IL-7 R alpha is expressed on double negative (CD44-/CD8+) and
CD4+ or CD8+ single positive T cells as well as on CD8+ memory T cells and
their precursors. It is expressed early in B cell development, prior to the
appearance of surface IgM. In mouse, IL-7 activation of IL-7 R alpha is
critical for both T cell and B cell lineage development. IL-7 induces the
downregulation and shedding of cell surface IL‑7 R alpha.IL-7 R
alpha additionally associates with TSLP R to form the functional receptor for
thymic stromal lymphopoietin.TSLP indirectly regulates T cell development by
modulating dendritic cell activation. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|