LAG-3 GST Tag Protein, Human,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Antigen	LAG-3
Synonyms	LAG-3,CD223 Antigen, Protein FDC, CD223, FDC, sLAG-3
Accession	P18627
Amino Acid Sequence	Leu23-Leu450, with N-terminal GST Tag MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKGGGSGGGSDDDDKLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL
Expression System	HEK293
Molecular Weight	75-80kDa (Reducing)
Purity	＞95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	GST Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1.Colin G. Graydon, Shifa Mohideen and Keith R.Fowke, LAG3’s Enigmatic Mechanism of Action. Frontiers in Immunology

Background

LAG3 is a member of the immunoglobulin superfamily and a CD4 ancestral homolog, resulting from a gene duplication event. Like CD4, LAG3 binds MHC class II (MHCII), but also FGL-1,α-synuclein fibrils (α-syn) and the lectins galectin-3 (Gal-3) and lymph node sinusoidal endothelial cell C-type lectin (LSECtin). As an immune checkpoint, LAG3 inhibits the activation of its host cell and generally promotes a more suppressive immune response. On T cells, LAG3 reduces cytokine and granzyme production and proliferation while encouraging differentiation into T regulatory cells.