ROBO4 His Tag Protein, Mouse,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Mouse
Antigen	ROBO4
Synonyms	roundabout, axon guidance receptor, homolog 4 (Drosophila)
Accession	Q8C310
Amino Acid Sequence	Leu28-Glu470, with C-terminal 8*His LDSPPQILVHPQDQLLQGSGPAKMRCRSSGQPPPTIRWLLNGQPLSMATPDLHYLLPDGTLLLHRPSVQGRPQDDQNILSAILGVYTCEASNRLGTAVSRGARLSVAVLQEDFQIQPRDTVAVVGESLVLECGPPWGYPKPSVSWWKDGKPLVLQPGRRTVSGDSLMVSRAEKNDSGTYMCMATNNAGQRESRAARVSIQESQDHKEHLELLAVRIQLENVTLLNPEPVKGPKPGPSVWLSWKVSGPAAPAESYTALFRTQRSPRDQGSPWTEVLLRGLQSAKLGGLHWGQDYEFKVRPSSGRARGPDSNVLLLRLPEQVPSAPPQGVTLRSGNGSVFVSWAPPPAESHNGVIRGYQVWSLGNASLPAANWTVVGEQTQLEIATRLPGSYCVQVAAVTGAGAGELSTPVCLLLEQAMEQSARDPRKHVPWTLEQLRATLRRPEGGGSHHHHHHHH
Expression System	HEK293
Molecular Weight	60-75kDa (Reducing)
Purity	＞95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1.Xiao, W., Pinilla-Baquero, A., Faulkner, J. etal. Robo4 is constitutively shed by ADAMs from endothelial cells and the shedRobo4 functions to inhibit Slit3-induced angiogenesis. Sci Rep 12, 4352 (2022).https://doi.org/10.1038/s41598-022-08227-8.

Background

Roundabout homolog 4, also known as magic roundabout and ROBO4 is a member of the immunoglobulin superfamily and ROBO family.Roundabout 4 (Robo4) is a transmembrane receptor that expresses specifically in endothelial cells. ROBO4 contains two fibronectin type-III domains and two Ig-like C2-type (immunoglobulin-like) domains. ROBO4 is predominantly expressed in embryonic or tumor vascular endothelium and is considered important for vascular development and as a candidate tumor endothelial marker. ADAM10 and ADAM17 are abscisic enzymes of Robo4, and the negative regulation of their ligand Slit3 is a new control mechanism of Robo4 signaling in angiogenesis.

Protocol

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.