Product Specification| Species | Human | | Antigen | SerpinF1/PEDF | | Synonyms | SERPINF1,Serpin F1,PEDF,PIG35,EPC-1 | | Accession | P36955 | | Amino Acid Sequence | Gln20-Pro418,
with C-terminal 8*His QNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGPGGGSHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | 47-53kDa (Reducing) | | Purity | >95% by SDS-PAGE | | Endotoxin | <0.1EU/μg | | Conjugation | Unconjugated | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4 | | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
| | Reference | 1.Published online 2022 Feb 15. doi: 10.1016/j.pep.2022.106072.
|
BackgroundHuman SERPINF1 gene
codes for pigment epithelium-derived factor, a secreted glycoprotein and member
of the SERPIN superfamily. Pigment epithelium-derived factor, also known as
PEDF, Serpin F1, and SERPINF1, is a multiple functional protein that has both
anti-angiogenic activity and neurotrophic activity at the same time.PEDF has
affinity for PEDF-receptor (PEDF-R), a membrane-linked lipase encoded by the
PNPLA2 gene.PEDF is also responsible for apoptosis of endothelial cells either
through the p38 MAPK pathway or through the FAS/FASL pathway.PEDF has a variety
of functions including antiangiogenic, antitumorigenic, and neurotrophic
properties. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|