Product SpecificationSpecies | Human | Antigen | TSLPR | Synonyms | CRLF2, CRL2, ILXR, TSLPR | Accession | Q9HC73 | Amino Acid Sequence | Gln23-Lys231, with C-terminal 8* His QGGAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKGGGSHHHHHHHH | Expression System | HEK293 | Molecular Weight | 33-43kDa (Reducing) | Purity | >95% by SDS-PAGE | Endotoxin | <0.1EU/μg | Conjugation | Unconjugated | Tag | His Tag | Physical Appearance | Lyophilized Powder | Storage Buffer | PBS, pH7.4 | Reconstitution | Reconstituteat 0.1-1 mg/ml according to the size in ultrapure water after rapidcentrifugation. | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
| Reference | 1.L S Park. Cloning of the murine thymic stromallymphopoietin (TSLP) receptor: Formation of a functional heteromeric complexrequires interleukin 7 receptor. J Exp Med. 2000 Sep 4;192(5):659-70.
|
BackgroundThe
TSLP receptor (TSLPR, CRLM-2), a typical heterodimeric cytokine receptor
consisting of a TSLP binding subunit (TSLPRα) and the α-subunit of the IL-7
receptor (IL-7Rα). TSLPR mRNA has been detected on many immune cell types,
including dendritic cells (DCs), T cells, B cells, mast cells, NKT cells and
monocytes as well as in tissues from heart, skeletal muscle, kidney and liver.
TSLPR has low affinity for TSLP, but in combination with IL-7Rα generates a
high affinity binding site for TSLP and triggers signaling. The TSLPR regulates
target gene expression via the JAK/STAT signalling pathway with participation
of signal transducers and activators of transcription STAT3, STAT5 and STAT1.
Genetic, experimental, and clinical evidence suggests that the TSLP-TSLPR
pathway is associated with the pathogenesis of allergic diseases such as atopic
dermatitis (AD) and asthma. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|