Product SpecificationSpecies | Human | Antigen | TWEAKR/TNFRSF12A | Synonyms | TNFRSF12A,FGF-inducible 14,FN14,TweakR,CD266 | Accession | Q9NP84 | Amino Acid Sequence | Glu28-Trp79,
with N-terminal Human IgG Fc PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKIEGREQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLW | Expression System | HEK293 | Molecular Weight | 33-35kDa (Reducing) | Purity | >95% by SDS-PAGE | Endotoxin | <0.1EU/μg | Conjugation | Unconjugated | Tag | Human Fc Tag | Physical Appearance | Lyophilized Powder | Storage Buffer | PBS, pH7.4 | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
| Reference | 1.Feng, S. et al. (2000) Am J. Pathol.156:1253. |
BackgroundTNFRSF12A was
initially identified as a fibroblast growth factor-1-inducible gene in murine
NIH 3T3 cells, and was named as fibroblast growth factor-inducible-14 (Fn14)
gene. Human TNFRSF12A was cloned from
a HUVEC cDNA library and identified as the TWEAK receptor and a member of the
TNFR family. TNFRSF12A is highly expressed in heart, placenta and kidney.
TNFRSF12A / FN14 promotes angiogenesis and the proliferation of endothelial
cells. TNFRSF12A and its ligand play a key role in muscle atrophy, cerebral
ischemia, kidney injury, atherosclerosis, experimental autoimmune encephalitis,
rheumatoid arthritis, and inflammatory bowel disease. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|