Frizzled-4/FZD4 Fc Chimera Protein, Human,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Antigen	Frizzled-4/FZD4
Synonyms	Fz-4, hFz4, Frizzled-4
Accession	Q9ULV1
Amino Acid Sequence	Phe37-Glu180, with C-terminal Human IgG Fc FGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEEIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Expression System	HEK293
Molecular Weight	50-55 kDa (Reducing)
Purity	>95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	Human Fc Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1.Hiroyuki Kirikoshi, Norihiko Sagara, Jun Koike, Katsuaki Tanaka, Hisahiko Sekihara, Momoki Hirai, Masaru Katoh. Molecular Cloning and Characterization of Human Frizzled-4 on Chromosome 11q14-q21. [J]. Biochemical and Biophysical Research Communications, 1999(3):955-961.2.Ke Zhang, Qun Lv, Liming Li, Mingjun Jiang, Fang Fang. Discovering the role of FZD4 Gene in human cutaneous squamous cell carcinoma.[G]. Indian Journal of Dermatology,2021-66-5-(484-489).

Background

Frizzled 4 (FZD4) is an important receptor for WNT proteins that stimulate several downstream signaling pathways. The FZD4 gene has been mapped to human chromosome 11q14-q21. FZD4 spans a total of 7392 nucleotides and encodes a 537-amino-acid protein with the N-terminal cysteine-rich domain, seven transmembrane domains, and the C-terminal S/T-X-V motif. The FZD4 mRNA of 7.7 kb in size were detected almost ubiquitously in normal human tissues and larger amounts in fetal kidney, adult heart, skeletal muscle, and ovary. Among cancer cell lines, the FZD4 mRNA level was higher in HeLa S3. The FZD4-Wnt interaction is involved in many types of cancers. The role of FZD4 in cutaneous squamous cell carcinoma (CSCC) has not been well studied.