|
FcRn His Tag Protein, Cynomolgus
| Origin of place |
Singapore  |
| Model |
UA010417-100μg |
| Supplier |
ANT BIO PTE.LTD. |
| Price |
840 |
| Hits |
49 |
| Updated |
3/2/2026 |
|
Product Specification| Species | Cynomolgus | | Synonyms | FcRn, FCGRT & B2M | | Accession | Q8SPV9(FcRn) | | Amino Acid Sequence | FcRn:Ala24-Ser297, with C-terminal 8*His
AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYDSLRGQAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELSPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPGNPGFSVLTCSAFSFYPPELQLRFLRNGMAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELETPAKSSGGGSHHHHHHHH
B2M:Ile21-Met119
IQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM | | Expression System | HEK293 | | Molecular Weight | 32-35&11-13kDa (Reducing) | | Purity | >95% by SDS-PAGE | | Endotoxin | <0.1EU/μg | | Conjugation | Unconjugated | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4 | | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
| | Reference | 1.Roopenian D. et al. (2007) FcRn: the neonatal Fc receptor comes of age. Nat Rev Immunol. 7: 715-725. |
BackgroundFcRn is an unusual Fc receptor, the biological importance of which is only beginning to be fully appreciated. In addition to its critical role in the transfer of maternal IgG to the fetus or neonate, FcRn is the homeostatic receptor responsible for extending the serum half-life of IgG in adults. The exact site(s) of IgG protection from degradation has not been delineated in vivo, but both endothelial cells and bone-marrow-derived cells can extend the serum persistence of IgG. FcRn is also expressed in many other tissues in the adult animal, including barrier sites such as the blood–brain interface, the glomerular filter in the kidneys and the intestinal epithelium. FcRn expression at these sites merits further study with the goals of modulating specific IgG transport to promote host defence or to control immune-complex deposition. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|