KMT5A His Tag Protein, Human,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Antigen	KMT5A
Synonyms	kmt5a,setd8N-lysine methyltransferase KMT5A, Histone-lysine N-methyltransferase KMT5A, Lysine-specific methylase 5A,SET domain-containing protein 8
Accession	Q9NQR1-2
Amino Acid Sequence	Lys195-His352 HHHHHHHHKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH
Expression System	E.coli
Molecular Weight	19.1kDa (Reducing)
Purity	>95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	20mM Tris,300mM NaCl, pH8.0.
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.
Reference	1.Nishioka K, et al.(2002) PR-Set7 is a nucleosome-specific methyltransferase that modifies lysine 20 of histone H4 and is associated with silent chromatin.Mol Cell.Jun;9(6):1201-13. 2. Jia Fang et al. (2002)Purification and functional characterization of SET8, a nucleosomal histone H4-lysine 20-specific methyltransferase. Curr Biol. 2002 Jul 9;12(13):1086-99.

Background

KMT5A (SETD8/Pr-SET7/KMT5A) is an important member of the methyltransferase family. It is a specific single methyltransferase of histone lysine H4K20 and participates in a variety of biological processes such as transcriptional regulation, cell cycle regulation, DNA damage. Protein-lysine N-methyltransferase that monomethylates both histones and non-histone proteins. Especially monomethylates 'Lys-20' of histone H4 (H4K20me1). H4K20me1 is enriched during mitosis and represents a specific tag for epigenetic transcriptional inhibition. It mainly plays a role in the euchromatin region, thus playing a central role in the euchromatic gene silencing.