|
KMT5A His Tag Protein, Human
Origin of place |
Singapore  |
Model |
UA070019-10μg |
Supplier |
ANT BIO PTE.LTD. |
Price |
178 |
Hits |
18 |
Updated |
9/1/2025 |
|
Product SpecificationSpecies | Human | Antigen | KMT5A | Synonyms | kmt5a,setd8N-lysine methyltransferase KMT5A, Histone-lysine N-methyltransferase KMT5A, Lysine-specific methylase 5A,SET domain-containing protein 8 | Accession | Q9NQR1-2 | Amino Acid Sequence | Lys195-His352 HHHHHHHHKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH | Expression System | E.coli | Molecular Weight | 19.1kDa (Reducing) | Purity | >95% by SDS-PAGE | Endotoxin | <0.1EU/μg | Conjugation | Unconjugated | Tag | His Tag | Physical Appearance | Lyophilized Powder | Storage Buffer | 20mM Tris,300mM NaCl, pH8.0. | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles. | Reference | 1.Nishioka K, et al.(2002) PR-Set7 is a nucleosome-specific methyltransferase that modifies lysine 20 of histone H4 and is associated with silent chromatin.Mol Cell.Jun;9(6):1201-13.
2. Jia Fang et al. (2002)Purification and functional characterization of SET8, a nucleosomal histone H4-lysine 20-specific methyltransferase. Curr Biol. 2002 Jul 9;12(13):1086-99. |
BackgroundKMT5A (SETD8/Pr-SET7/KMT5A) is an important member of the methyltransferase family. It is a specific single methyltransferase of histone lysine H4K20 and participates in a variety of biological processes such as transcriptional regulation, cell cycle regulation, DNA damage.
Protein-lysine N-methyltransferase that monomethylates both histones and non-histone proteins. Especially monomethylates 'Lys-20' of histone H4 (H4K20me1). H4K20me1 is enriched during mitosis and represents a specific tag for epigenetic transcriptional inhibition. It mainly plays a role in the euchromatin region, thus playing a central role in the euchromatic gene silencing. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|