Product Specification| Species | Human | | Antigen | IgG | | Synonyms | IgG1 Fc, Ig gamma-1 chain C region, IGHG1 | | Accession | P01857-1 | | Amino Acid Sequence | Pro100-Lys330(C103S), with C-terminal Flag Tag
PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKAAADYKDDDDK | | Expression System | HEK293 | | Molecular Weight | 28-33kDa (Reducing) | | Purity | >95% by SDS-PAGE | | Endotoxin | <0.1EU/μg | | Conjugation | Unconjugated | | Tag | Flag Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4 | | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
|
BackgroundImmunoglobulin G (IgG) is a monomer immunoglobulin, mainly involved in Immunoglobulin G (IgG) is a monomer immunoglobulin, mainly involved in secondary antibody reaction, plasma B cell synthesis and secretion, constitute 75% of human serum immunoglobulin. There are four subtypes of human IgG antibodies: IgG1, IgG2, IgG3, IgG4; mice IgG can be divided into five subtypes; IgG1, IgG2A, IgG2B, IgG2C and IgG3; rats have four subtypes: IgG1, IgG2A, IgG2B and IgG2C. The nomenclature of IgG subtypes of different species is independent, so there is no correlation among different genera. The content of IgG1 in serum accounts for about 60%, and the half-life in serum is about 21 days. After pepsin cleavage, IgG1 is divided into two antigenic binding sites F (ab) s and a highly conserved Fc fragment, and Fc has a highly conserved N-glycosylation site. IgG1 is the most potential subtype in tumor immunotherapy. The active form of IgG1 is bivalent monomer, and human IgG1 can also bind to mouse Fc γ receptor, so the obvious effect can be observed in mouse model. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|