|
GFP His Tag protein, Aequorea victoria
Origin of place |
Singapore  |
Model |
UA070020-50μg |
Supplier |
ANT BIO PTE.LTD. |
Price |
264 |
Hits |
2 |
Updated |
8/27/2025 |
|
Product SpecificationSpecies | Aequorea victoria | Antigen | GFP | Synonyms | GFP Protein | Accession | AAB65663 | Amino Acid Sequence | Ser2-Lys238, with N-terminal 8*His
HHHHHHHHSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK | Expression System | E.coli | Molecular Weight | 27.8kDa | Purity | >95% by SDS-PAGE&RP-HPLC | Endotoxin | <0.1EU/μg | Conjugation | Unconjugated | Tag | His Tag | Physical Appearance | Lyophilized Powder | Storage Buffer | PBS, pH7.4 | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles. | Reference | 1.Trends Biochem Sci 1995 Nov;20(11):448-55.
2.Biol Chem. 1998 Dec 25;273(52):34970-5. |
BackgroundThe green fluorescent protein (GFP) is a protein that exhibit bright green fluorescence when exposed to blue light. It is a widely used reporter in gene expression and protein localization studies. the green fluorescent protein (GFP) from the jellyfish Aequorea victoria is a widely used reporter in studies of gene expression and protein localization. GFP is a single chain polypeptide of 238 amino acids .Most of these amino acids form β sheets that are compacted through an antiparallel structure to form the barrel. So far, they have been used as reporters of gene expression, tracers of cell lineage, and as fusion tags to monitor protein localization within living cells. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|