GPA33 His Tag Protein, Mouse,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Mouse
Antigen	GPA33
Synonyms	Cell surface A33 antigen, Glycoprotein A33, GPA33, Glycoprotein A33 (Transmembrane), Transmembrane Glycoprotein A33, A33
Accession	Q9JKA5
Amino Acid Sequence	Leu22-Ile235, with C-terminal 8*His LTVETTQDILRAARGRSVTLPCTYNTYVSDREGFIQWDKLLRSQTERVVTWNFVTKKYIYGNRYENRVRVSNDAELSNASITIDQLTMDDNGTYECSVSLMSDQDVNAKSRVRLLVLVPPSKPDCSIQGEMVIGNNIQLTCHSAEGSPSPQYSWKSYNAQNQQRPLTQPVSGEPLLLKNISTETAGYYICTSSNDVGIESCNITVAPRPPSMNIGGGSHHHHHHHH
Expression System	HEK293
Molecular Weight	33-40kDa
Purity	>95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1.Heath, J. K. , White, S. J. , Johnstone, C. N. , Catimel, B. , Simpson, R. J. , Moritz, R. L. , Tu, G. F. , et al. The human A33 antigen is a transmembrane glycoprotein and a novel member of the immunoglobulin superfamily. Proc. Natl. Acad. Sci. U. S. A. 1997. 94: 469-474.

Background

Glycoprotein A33 (GPA33) is also known as Cell surface A33 antigen, is a single-pass type I membrane protein which is expressed in normal gastrointestinal epithelium and in 95% of colon cancers.GPA33 has high homology with CD2 and contains a V‐type Ig‐like domain at the N terminus. It is also related to proteins that have inhibitory roles in T cell activation, such as CD276 (B7‐H3) and VSIG4 and several cell adhesion molecules, such as CEACAM, ICAM, and NCAM (3D‐Protein BLAST, NCBI). Although its molecular function is not known, GPA33 has been associated with immune dysregulation. GPA33 may play a role in cell-cell recognition and signaling.