|
JAM-C His Tag Protein, Mouse
Origin of place |
Singapore  |
Model |
UA010507-100μg |
Supplier |
ANT BIO PTE.LTD. |
Price |
604 |
Hits |
13 |
Updated |
9/1/2025 |
|
Product SpecificationSpecies | Mouse | Antigen | JAM-C | Synonyms | CD323; JAM-2; JAM3; JAMC; JAM-C; JAM-CFLJ14529; junctional adhesion molecule 3JAM-3; junctional adhesion molecule C | Accession | Accession#: Q9D8B7 | Amino Acid Sequence | Glu30-Asn241, with C-terminal 8*His
EAVNLKSSNRNPVVHEFESVELSCIITDSQTSDPRIEWKKIQDGQTTYVYFDNKIQGDLAGRTDVFGKTSLRIWNVTRSDSAIYRCEVVALNDRKEVDEITIELIVQVKPVTPVCRIPAAVPVGKTATLQCQESEGYPRPHYSWYRNDVPLPTDSRANPRFQNSSFHVNSETGTLVFNAVHKDDSGQYYCIASNDAGAARCEGQDMEVYDLNGGGSHHHHHHHH | Expression System | HEK293 | Molecular Weight | 30-35kDa | Purity | >95% by SDS-PAGE | Endotoxin | <0.1EU/μg | Conjugation | Unconjugated | Tag | His Tag | Physical Appearance | Lyophilized Powder | Storage Buffer | PBS, pH7.4 | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
| Reference | 1.Chavakis, T. et al. (2003) Thromb. Haemost. 89:13.2.Aurrand-Lions, M. et al. (2001) Blood 98:3699.3.Spermatid differentiation requires the assembly of a cell polarity complex downstream of junctional adhesion molecule-C.Gliki G., Ebnet K., Aurrand-Lions M., Imhof B.A., Adams R.H.4.Antibody against junctional adhesion molecule-C inhibits angiogenesis and tumor growth.Lamagna C., Hodivala-Dilke K.M., Imhof B.A., Aurrand-Lions M. |
BackgroundThe family of junctional adhesion molecules (JAM), comprised of at least three members, are type I transmembrane receptors belonging to the immunoglobulin (Ig) superfamily. These proteins are localized in the tight junctions between endothelial cells or epithelial cells. Some family members are also found on blood leukocytes and platelets. Junctional adhesion protein that mediates heterotypic cell-cell interactions with its cognate receptor JAM2 to regulate different cellular processes. Plays a role in homing and mobilization of hematopoietic stem and progenitor cells within the bone marrow. At the surface of bone marrow stromal cells, it contributes to the retention of the hematopoietic stem and progenitor cells expressing JAM3. Plays a central role in leukocytes extravasation by facilitating transmigration through the endothelium. Plays a role in spermatogenesis where JAM2 and JAM3, which are respectively expressed by Sertoli and germ cells, mediate an interaction between both cell types and play an essential role in the anchorage of germ cells onto Sertoli cells and the assembly of cell polarity complexes during spermatid differentiation. Also functions as a counter-receptor for ITGAM, mediating leukocyte-platelet interactions and is involved in the regulation of transepithelial migration of polymorphonuclear neutrophils (PMN). bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|