Product SpecificationSpecies | Mouse | Antigen | TNFRSF10B/TRAIL R2 | Synonyms | TNFRSF10B,TRAILR2,TRAIL-R2,CD262,DR5,KILLER,TRICK2,ZTNFR9,TRICKB | Accession | Q9QZM4 | Amino Acid Sequence | Asn53-Ser177, with C-terminal 8*His
NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWASGGGSHHHHHHHH | Expression System | HEK293 | Molecular Weight | 20-33kDa | Purity | >95% by SDS-PAGE | Endotoxin | <0.1EU/μg | Conjugation | Unconjugated | Tag | His Tag | Physical Appearance | Lyophilized Powder | Storage Buffer | PBS, pH7.4 | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
| Reference | 1.Walczak, H. et al. (1997) EMBO J. 16:5386. |
BackgroundTNFRSF10B, also called TRAIL R2 and DR5, is a member of the TNF receptor superfamily. TRAIL-R2 contains two extracellular cysteine-rich repeats, typical for TNF receptor (TNFR) family members, and a cytoplasmic death domain. TNFRSF10B / DR-5 is widely expressed in adult and fetal tissues; very highly expressed in tumor cell lines. Human and mouse TRAIL R2 share 49% amino acid sequence similarity. Some studies have suggested that TNFRSF10B contributes more than TNFRSF10A (TRAIL R1) to TRAIL-induced apoptosis in cancer cells that express both receptors. In addition, agonistic monoclonal antibodies against TNFRSF10B, which can induce apoptosis in the absence of TRAIL, are used for cancer therapies. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|