Product Specification| Species | Human | | Antigen | B7-1 | | Synonyms | CD80, B7, B7-1, B7.1, BB1, CD28LG, CD28LG1, LAB7 | | Accession | P33681-1 | | Amino Acid Sequence | Val35-Asn242, with C-terminal Avi&His Tag
VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNGGGSGLNDIFEAQKIEWHEHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | 43-55kDa | | Purity | >95% by SDS-PAGE | | Endotoxin | <0.1EU/μg | | Conjugation | Biotin | | Tag | Avi Tag, His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4 | | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
| | Reference | 1. Carin C. Stamper, Yan Zhang, James F. Tobin, David V. Erbe, Shinji Ikemizu, Simon J. Davis, Mark L. Stahl, Jasbir Seehra, William S. Somers & Lidia Mosyak: Crystal structure of the B7-1/CTLA-4 complex that inhibits human immune responses, Nature volume 410, pages608-611 (2001). |
BackgroundAs the first identified B7 family member, CD80 is widely expressed in a broad spectrum of tissues, even on some malignant tumor cells, thereby suggesting the potential mechanism of immune evasion of tumor cells.CD80 is recognized as one of the most potent costimulatory molecules by which immune cells limit malignant growth. It is upregulated upon cell stress and it is critical for efficacious immune surveillance during carcinogenesis. Low surface expression of CD80 was reported as an immune escape mechanism of colon carcinoma; on the other hand, its expression resulted enhanced in high-frequency microsatellite instability (MSI) colorectal cancers, a CRC subtype which is highly immunogenic and associated with a better prognosis. Both in vivo and in vitro studies showed that the upregulation of CD80 on tumor cell surface successfully activates antitumor immune responses, while its expression is frequently lost during tumor progression probably due to selective pressure by the immune system. Thus, to develop effective approaches for cancer immunotherapy, strategies for enhancing CD80 expression in tumors are urgently required. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|