Biotinylated Fc γ RIIB/CD32b Avi&His Tag Protein, Human,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Antigen	Fc γ RIIB/CD32b
Synonyms	FCGR2B/C, CD32b/c, Fc RII-b/c, Fc-gamma RII-b/c, CD32, FCG2, IGFR2, CDw32
Accession	P31994-1
Amino Acid Sequence	Ala46-Pro217, with C-terminal Avi&His Tag APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPGGGSGLNDIFEAQKIEWHEHHHHHHHH
Expression System	HEK293
Molecular Weight	29-32kDa
Purity	＞95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Biotin
Tag	Avi Tag, His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1. Christopher T. Rankin, Maria-Concetta Veri, Sergey Gorlatov, Nadine Tuaillon, Steve Burke, Ling Huang, H. David Inzunza, Hua Li, Shannon Thomas, Syd Johnson, Jeffrey Stavenhagen, Scott Koenig, Ezio Bonvini: CD32B, the human inhibitory Fc-γ receptor IIB, as a target for monoclonal antibody therapy of B-cell lymphoma, Blood (2006) 108 (7): 2384-2391.

Background

IgG Fc region receptors are members of the Ig superfamily that play roles in activating or inhibiting immune responses such as degranulation, phagocytosis, ADCC, cytokine release, and B-cell proliferation. There are three genes for human Fc γ RII /CD32 (A, B, and C) and one for mouse Fc γ RII B (CD32B). CD32 is a low affinity receptor for IgG. CD32B is expressed on B cells and myeloid dendritic cells. Ligation of CD32B on B cells downregulates antibody production and may, in some circumstances, promote apoptosis.