Product SpecificationSpecies | Human | Antigen | PD-L1 | Synonyms | PD-L1, CD274, B7-H1, PDCD1L1, PDCD1LG1 | Accession | Q9NZQ7 | Amino Acid Sequence | Phe19-Arg238, with C-terminal Avi&His Tag
FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERGGGSGLNDIFEAQKIEWHEHHHHHHHH | Expression System | HEK293 | Molecular Weight | 33-40kDa | Purity | >95% by SDS-PAGE | Endotoxin | <0.1EU/μg | Conjugation | Biotin | Tag | Avi Tag, His Tag | Physical Appearance | Lyophilized Powder | Storage Buffer | PBS, pH7.4 | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
| Reference | 1. Joel Sunshine, Janis M Taube: PD-1/PD-L1 inhibitors, Current Opinion in Pharmacology, Volume 23, August 2015, Pages 32-38. |
BackgroundPDL1 is a cell surface immunoglobulin superfamily with two Ig-like domains within the extracellular region and a short cytoplasmic domain. PDL1 is also known as B7-H, B7H1, MGC142294, MGC142296, PD-L1, PDCD1L1 and PDCD1LG1,which is a member of the growing B7 family of immune molecules and is involved in the regulation of cellular and humoral immune responses. PD-L1 provides a molecular stop signal to the adaptive immune system helping to distinguish between self and foreign antigens. PDL1 may inhibit ongoing T-cell responses by inducing apoptosis and arresting cell-cycle progression.
Many cancers exhibit upregulated PD-L1 protein expression, and several cancers with high levels of PD-L1 have been associated with increased tumor aggressiveness and poor prognosis. Using new therapeutics that block the PD-L1:PD-1 interaction has proven successful in the clinic for many cancer types and has sparked great interest in the field of cancer immunotherapy. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|