Product SpecificationSpecies | Mouse | Antigen | EPCR/PROCR | Synonyms | Endothelial cell protein C receptor, Activated protein C receptor, APC receptor, EPCR, PROCR, CD201 | Accession | Q64695 | Amino Acid Sequence | Leu18-Ser214, with C-terminal 8*His
LCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGRSYTSGGGSHHHHHHHH | Expression System | HEK293 | Molecular Weight | 33-43kDa | Purity | >95% by SDS-PAGE | Endotoxin | <0.1EU/μg | Conjugation | Unconjugated | Tag | His Tag | Physical Appearance | Lyophilized Powder | Storage Buffer | PBS, pH7.4 | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
| Reference | 1. Montes, R. et al. (2012) Thromb. Haemost. 107:815.
2. Bae, J.-S. et al. (2007) Blood 110:3909.
3. Fink, K. et al. (2013) PLoS One 8:e53103.
4. Willcox, C.R. et al. (2012) Nat. Immunol. 13:872.
5. Turner, L. et al. (2013) Nature 498:502. |
BackgroundThe endothelial protein C receptor (EPCR), also known as CD201, is an approximately 50 kDa transmembrane glycoprotein expressed on vascular endothelial cells and functions as a negative regulator of thrombosis. EPCR inhibits thrombosis through its interactions with Protein C, activated Protein C (APC), and Coagulation Factors VII, and VIIa. It enhances the activation of Protein C in response to complexes of Thrombin-Thrombomodulin. In humans, a soluble form of EPCR can be produced by alternative splicing or ADAM17/TACE mediated shedding, and this protein inhibits the anti-coagulant activity of APC. EPCR can be degraded on the surface of endothelial cells by Neutrophil Elastase. Activation of EPCR also protects vascular endothelial cells from Thrombin-induced apoptosis. EPCR binds to CD11b/CD18 (Mac-1) on monocytes and mediates monocyte adhesion to the vascular endothelium. In addition, EPCR binds to the antigen receptor on gamma δ T cells, promotes hematopoietic stem cell retention in the bone marrow, and binds to surface proteins of some species of Plasmodium, contributing to pathogenicity in severe malaria. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|