CD34 Fc Chimera Protein, Mouse,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Mouse
Antigen	CD34
Synonyms	RP11-328D5.2, CD34 molecule, HPCA1
Accession	Q64314-1
Amino Acid Sequence	Thr35-Thr287, with C-terminal Human IgG Fc TTETSTQGISPSVPTNESVEENITSSIPGSTSHYLIYQDSSKTTPAISETMVNFTVTSGIPSGSGTPHTFSQPQTSPTGILPTTSDSISTSEMTWKSSLPSINVSDYSPNNSSFEMTSPTEPYAYTSSSAPSAIKGEIKCSGIREVRLAQGICLELSEASSCEEFKKEKGEDLIQILCEKEEAEADAGASVCSLLLAQSEVRPECLLMVLANSTELPSKLQLMEKHQSDLRKLGIQSFNKQDIGSHQSYSRKTIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Expression System	HEK293
Molecular Weight	72-95kDa
Purity	>95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	Human Fc Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1. Laura E Sidney, Matthew J Branch, Siobhán E Dunphy, Harminder S Dua,and Andrew Hopkinson. Concise Review: Evidence for CD34 as a Common Marker for Diverse Progenitors. Stem Cells. 2014 Jun; 32(6): 1380-1389.Published online 2014 May 23.

Background

CD34 is predominantly regarded as a marker of hematopoietic stem cells (HSC) and hematopoietic progenitor cells. However, CD34 is now also established as a marker of several other nonhematopoietic cell types, including vascular endothelial progenitors and embryonic fibroblasts. Accumulating evidence demonstrates CD34 expression on several other cell types, including multipotent mesenchymal stromal cells (MSC), interstitial dendritic cells, and epithelial progenitors, but there remains limited recognition of the role of CD34-positive (CD34+) cells outside of each individual specialty.