IL-7 Protein, Human,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	Interleukin-7
Accession	P13232
Amino Acid Sequence	Asp26-His177 with C-terminal 6*His Tag DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHHHHHHH
Expression System	HEK293
Molecular Weight	18-30 kDa (Reducing)
Purity	＞95% by SDS-PAGE
Endotoxin	<1EU/mg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	10 mM PBS, pH 7.4.
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1. Proc Natl Acad Sci U S A. 1989 Jan;86(1):302-6. 2. J Biol Chem. 1997 Dec 26;272(52):32995-3000. 3. J Immunol. 1995 Jan 1;154(1):58-67.

Background

Interleukin 7（IL-7）is a mature protein of 177 amino acids with a signal sequence of 25 amino acids and a calculated mass of 17.4kDa. Recombinant human IL-7 stimulated the proliferation of murine pre-B cells and was active on cells harvested from human bone marrow that are enriched for B-lineage progenitor cells.

IL-7 is a proteinaceous biological response modifier that has a bioactive tertiary structure dependent on disulfide bond formation.

IL-7-stimulated pro-B cells partially differentiated into a pre-B cell population, on the basis of the loss of CD34 and terminal deoxynucleotidyl (TdT) expression, and the acquisition of cytoplasmic mu heavy chains.