|
IL-7 Protein, Human
Origin of place |
Singapore  |
Model |
UA040118-10μg |
Supplier |
ANT BIO PTE.LTD. |
Price |
236 |
Hits |
15 |
Updated |
9/1/2025 |
|
Product SpecificationSpecies | Human | Synonyms | Interleukin-7 | Accession | P13232 | Amino Acid Sequence | Asp26-His177 with C-terminal 6*His Tag DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHHHHHHH | Expression System | HEK293 | Molecular Weight | 18-30 kDa (Reducing) | Purity | >95% by SDS-PAGE | Endotoxin | <1EU/mg | Conjugation | Unconjugated | Tag | His Tag | Physical Appearance | Lyophilized Powder | Storage Buffer | 10 mM PBS, pH 7.4. | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
| Reference | 1. Proc Natl Acad Sci U S A. 1989 Jan;86(1):302-6.
2. J Biol Chem. 1997 Dec 26;272(52):32995-3000.
3. J Immunol. 1995 Jan 1;154(1):58-67. |
BackgroundInterleukin 7(IL-7)is a mature protein of 177 amino acids with a signal sequence of 25 amino
acids and a calculated mass of 17.4kDa. Recombinant human IL-7 stimulated the
proliferation of murine pre-B cells and was active on cells harvested from
human bone marrow that are enriched for B-lineage progenitor cells. IL-7 is a proteinaceous biological response modifier that has a bioactive
tertiary structure dependent on disulfide bond formation. IL-7-stimulated pro-B cells partially differentiated into a pre-B cell
population, on the basis of the loss of CD34 and terminal deoxynucleotidyl
(TdT) expression, and the acquisition of cytoplasmic mu heavy chains. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|