Product Specification| Species | Human | | Antigen | VSIG3/IGSF11 | | Synonyms | VSIG3, IgSF11, CXADRL1, Bt-IgSF, CT119 | | Accession | Q5DX21-1 | | Amino Acid Sequence | Leu23-Gly241, with C-terminal 8*His
LEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIGGGGSHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | 32-35kDa | | Purity | >95% by SDS-PAGE | | Conjugation | Unconjugated | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4 | | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles. | | Reference | 1. Suzu S, Hayashi Y, Harumi T, Nomaguchi K, Yamada M, Hayasawa H, et al. Molecular cloning of a novel immunoglobulin superfamily gene preferentially expressed by brain and testis. Biochem Biophys Res Commun (2002) 296(5):1215-21. |
BackgroundVSIG3 (V-set and immunoglobulin domain containing 3) is a member of the immunoglobulin superfamily (IgSF), which is also called the immunoglobulin superfamily 11 gene (IgSF11), and it is highly expressed in the brain and testis. Mature human VSIG3 consists of a 219 amino acid (aa) extracellular domain (ECD) that contains two tandem Ig-like domains, a 21 aa transmembrane segment, and a 169 aa cytoplasmic domain. The function of VSIG3 is to stimulate cell growth through homophilic interactions. In clinical, the VSIG3 has been reported to as a novel target for cancer immunotherapy of gastrointestinal and hepatocellular carcinomas. In addition, VSIG-3 is also a ligand of B7 family member VISTA/PD-1H and inhibits human T-cell functions through a novel VSIG-3/VISTA pathway. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|