DMBT1 His Tag Protein, Human,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	GP340 Protein, muclin
Accession	Accession#:Q9UGM3-2
Amino Acid Sequence	Thr20-Ser220, with C-terminal 8*His TGGWIPRTTDYASLIPSEVPLDPTVAEGSPFPSESTLESTVAEGSPISLESTLESTVAEGSLIPSESTLESTVAEGSDSGLALRLVNGDGRCQGRVEILYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPGNAWFGQGSGPIALDDVRCSGHESYLWSCPHNGWLSHNCGHGEDAGVICSAAQPQSTLRPESWPVRISGGGSHHHHHHHH
Expression System	HEK293
Molecular Weight	35-50kDa
Purity	>95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1． Review Int J Mol Sci . 2010;11(12):5212-33. Epub 2010 Dec 17.

Background

DMBT1(missing in malignant brain tumor 1), also known as glycoprotein 340 and salivary agglutinin, is a secreted protein that belongs to the DMBT1 family. DMBT1 is highly expressed in alveolar and macrophage tissues. In some macrophages, expression is visible on the membrane, while in other macrophages, it is strongly expressed in the phagosome/phagolysosomal chamber. It is expressed in the lungs, trachea, salivary glands, small intestine and stomach. In the pancreas, it is expressed in certain cells on the island of Langerhans. DMBT1 plays an important role in innate immune response.Recent studies identify DMBT1 as a high affinity ligand of Siglec-8 in human airways.