IL-3 Rα/CD123 His Tag Protein, Cynomolgus,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Cynomolgus
Synonyms	IL3R, IL3RA, IL-3Ra, IL-3R-alpha, IL3RAY, IL3RX, IL3RY, CD123 antigen, hIL3Ra, hIL-3Ra, MGC34174, IL-3 R alpha
Accession	G8F3K3-1
Amino Acid Sequence	Arg18-Arg302, with C-terminal 8*His RTKEDPNAPIRNLRMKEKAQQLMWDLNRNVTDVECIKGTDYSMPAMNNSYCQFGAISLCEVTNYTVRVASPPFSTWILFPENSGTPRAGAENLTCWVHDVDFLSCSWVVGPAAPADVQYDLYLNNPNSHEQYRCLHYKTDARGTQIGCRFDDIAPLSRGSQSSHILVRGRSAAVSIPCTDKFVFFSQIERLTPPNMTGECNETHSFMHWKMKSHFNRKFRYELRIQKRMQPVRTEQVRDTTSFQLPNPGTYTVQIRARETVYEFLSAWSTPQRFECDQEEGASSRGGGSHHHHHHHH
Expression System	HEK293
Molecular Weight	50-65kDa
Purity	>95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1. LIU, KEQIANG, ZHU, MENGRU, HUANG, YAO, et al. CD123 and its potential clinical application in leukemias [J]. Life sciences,2015,122(1):59-64.

Background

Human IL-3 Rα is expressed from human 293 cells. It contains AA Thr19 - Arg305. This protein carries a polyhistidine tag at the C-terminus. Interleukin 3 receptor alpha (low affinity) (IL3RA), also known as CD123 (Cluster of Differentiation 123) is a 45-62kDa glycoprotein member of the hematopoietin receptor superfamily. This protein associates with a beta subunit common to the receptors for IL-5 and granulocyte-macrophage colony-stimulating factor (GM-CSF) to form a high-affinity receptor for IL-3. The interleukin-3 receptor α chain (CD123) has been identified as a potential immunotherapeutic target because it is overexpressed in AML compared with normal hematopoietic stem cells.