Biotinylated CD52 Fc&Avi Tag Protein, Human,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	Epididymis Secretory Sperm Binding Protein Li 171mP, CD52 Antigen (CAMPATH-1 Antigen), Epididymal Secretory Protein E5, He5, CDW52 Antigen, HEL-S-171mP, EDDM5, CDw52, Cambridge pathology 1 antigen, Human epididymis-specific protein 5, CD52 Molecule
Accession	P31358
Amino Acid Sequence	Gly25-Ser36, with C-terminal human IgG1 Fc &Avi tag GQNDTSQTSSPSIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE
Expression System	HEK293
Molecular Weight	35-43kDa
Purity	>95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Biotin
Tag	Avi Tag, Mouse Fc Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1. Koyama K. et al. (2009) Functional aspects of CD52 in reproduction. J Reprod Immunol. 83(1-2): 56-59. 2. Morris, P.J. and N.K. Russell (2006) Transplantation 81:1361. 3. Redpath, S. et al. (1998) Immunology 93:595. 4. Hardiyanto, L. et al. (2012) J. Reprod. Immunol. 94:142.

Background

CD52, also known as CAMPATH-1 antigen, HE5, and gp20, is a cell surface glycoprotein that can be targeted to induce immune suppression by complement-mediated cell lysis. CD52 is a GPI-anchored protein present in lymphocytes and male reproductive tissues (mrt) including mature sperm and seminal plasma. It has been shown that mrt-CD52 is synthesized in epithelial cells of the epididymis and vas deferens, but not in the testis. The mrt-CD52 is transported to mature sperm during sperm transition in the male reproductive tract. Lymphocyte CD52 functions to stimulate suppressor T cell induction, while mrt-CD52 is associated with seminogelin and involved in clot formation and liquefaction of semen. It protects sperm against anti-sperm antibodies by binding to C1q and inhibiting complement activation.