Product SpecificationSpecies | Human | Synonyms | NCA | Accession | P40199-1 | Amino Acid Sequence | Lys35-Gly320, with C-terminal His&Avi tag
KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGGGGSGGGSHHHHHHHHHHGLNDIFEAQKIEWHE | Expression System | HEK293 | Molecular Weight | 50-72kDa | Purity | >95% by SDS-PAGE | Endotoxin | <0.1EU/μg | Conjugation | Biotin | Physical Appearance | Lyophilized Powder | Storage Buffer | PBS, pH7.4 | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
| Reference | 1. Laura A Strickland,Preclinical evaluation of carcinoembryonic cell adhesion molecule (CEACAM) 6 as potential therapy target for pancreatic adenocarcinoma,Journal of Pathology,J Pathol 2009; 218: 380-39. |
BackgroundCEACAM6 is a glycosylphosphoinosi-tol (GPI)-linked, cell surface protein and a member of the CEA family of proteins. Structurally, this protein has two C2-type Ig domains and a single N-terminal V-type Ig domain and shares close homology with CEACAM1, CEACAM7 and CEACAM8. Function-ally, CEACAM6 has been implicated in cell adhesion, cellular invasiveness, resistance to anoikis and metastatic behaviour of tumour cells, which are properties investigators have previously tried to exploit using various CEACAM6-targeted therapy approaches. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|