CD68/SR-D1 His Tag Protein, Human,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	GP110, LAMP4, SCARD1
Accession	P34810
Amino Acid Sequence	Asn22-Ser319, with C-terminal 8*His NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRSGGGSHHHHHHHH
Expression System	HEK293
Molecular Weight	55-95kDa
Purity	>95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1． nature laboratory investigation pathobiology in focus article Published: 21 November 2016 CD68/macrosialin.

Background

CD68 is a highly glycosylated glycoprotein, which has structural similarities with lysosome associated membrane protein (LAMP) and belongs to the LAMP family. Human CD68 contains 354 amino acids (aa), with a 21 aa signal sequence and a 298 aa extracellular domain (ECD), a 25 aa transmembrane domain, and a 10 aa cytoplasmic domain. CD68 is highly expressed by blood monocytes and tissue macrophages. CD68 plays a role in macrophage phagocytosis, intracellular lysosomal metabolism, extracellular cell-cell and cell-pathogen interactions. CD68 can be used alone or in combination with other cell markers of tumor-associated macrophages as a prognostic marker for cancer patient survival, showing good predictive value.