PlGF-2/PLGF/PGF Protein, Mouse,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Mouse
Synonyms	PGF, PLGF, PlGF2, PlGF, PGFL, SHGC-10760
Accession	P49764-1
Amino Acid Sequence	Val19-Pro158, with C-terminal 8*His VHSQGALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHPGGGSHHHHHHHH
Expression System	HEK293
Molecular Weight	25-33kDa
Purity	>95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1. Review ProgRetin Eye Res.2019 Mar;69:116-136.Epub 2018 Oct 30.

Background

Placental growth factor (PGF), also known as vascular endothelial growth factor-related proteins PLGF and PlGF2, is a member of the vascular endothelial growth factor (VEGF) family. PlGF is a three-dimensional structure composed of 149 amino acids. PlGF is a dimeric glycoprotein formed by a 69kD α chain and a 34kD β chain connected by disulfide bond, with a unique cystine junction. These junctions are characterized by eight spatially conserved cysteines that are involved in intramolecular and intermolecular disulfide bond formation. PlGF is a pleiotropic factor affects different cell types and regulates various biological responses.PGF is not only activated during angiogenesis and endothelial cell growth, stimulating their proliferation and migration, but also promoting cell tumor growth.