Login    Join free Add to favorites    中文
Home >Products> Reagents >Other Reagents> Human papillomavirus type 16 E7 Protein
Human papillomavirus type 16 E7 Protein
Human papillomavirus type 16 E7 Protein
Origin of place Singapore
Model UA030079-25μg
Supplier ANT BIO PTE.LTD.
Price 240
Hits 29
Updated 9/1/2025
  • Product Detail
  • Company Profile

Product Specification


SpeciesHuman papillomavirus type 16
SynonymsHPV 16 E7
AccessionP03129
Amino Acid Sequence

Protein sequence (P03129, Met1-Pro98)
MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

Expression SystemE.coli
Molecular Weight

Predicted MW: 11.0 kDa Observed MW: 17 kDa

Purity

>95% by SDS-PAGE

ConjugationUnconjugated
TagNo Tag
Physical AppearanceLyophilized Powder
Storage Buffer0.2M PBS, pH7.4
Reconstitution

Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

Stability & Storage· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Human papilloma viruses (HPVs) can be classified as either high-risk or low-risk according to their association with cancer. HPV16 and HPV18 are the most common of the high-risk group while HPV6 and HPV11 are among the low-risk types. Approximately 90% of cervical cancers contain HPV DNA of the high-risk types. Mutational analysis have shown that the E6 and E7 genes of the high-risk HPVs are necessary and sufficient for HPV transforming function. The specific interactions of the E6 and E7 proteins with p53 and pRB, respectively, correlate with HPV high and low risk classifications. The high-risk HPV E7 proteins bind to pRB with a higher affinity than do the low-risk HPV proteins. Human papillomavirus (HPV) E7 plays a major role in HPV-induced malignancy, perturbing cell cycle regulation, and driving cell proliferation. Major targets of cancer-causing HPV E7 proteins are the pRB family of tumor suppressors, which E7 targets for proteasome-mediated degradation and whose interaction is promoted through an acidic patch, downstream of the LXCXE motif in E7, that is subject to phosphorylation by casein kinase II (CKII).

bio-equip.cn
Request Infomation

* Name:
Title:
* Tel:
Fax:
* E-mail:
Postcode:
Institution/Company:
Address:
* Country:
Request infomation:
yes no
Request Quotation:
yes no
* Message:
Validated Code:
refresh
I agree to share my inquiry to the other matching suppliers.



Recently viewed products
Copyright(C) 2006-2025 Bio-Equip    E-mail:web@bio-equip.cn   沪ICP备06040519号