Product SpecificationSpecies | Human | Synonyms | PR domain zinc finger protein 1, BLIMP-1, Beta-interferon gene positive regulatory domain I-binding factor, PR domain-containing protein 1, Positive regulatory domain I-binding factor 1 (PRDI-BF1; PRDI-binding factor 1), BLIMP1 | Accession | O75626 | Amino Acid Sequence | Protein sequence (O75626, Lys38-Gln223, with C-His tag)
KMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLVWYCRDFAERLHYPYPGELTMMNLTQ | Expression System | E.coli | Molecular Weight | Predicted MW: 23.5 kDa
Observed MW: 25 kDa | Purity | 锛?5% by SDS-PAGE | Endotoxin | <1EU/渭g | Conjugation | Unconjugated | Tag | with C-His tag | Physical Appearance | Liquid | Storage Buffer | Supplied as a 0.2 渭m filtered solution of 0.2M PBS, pH7.4 with 5% glycerol. | Stability & Storage | 12 months from date of receipt, -20鈩?as supplied. |
BackgroundPRDM1 (PR domain zinc finger protein 1) is a transcription factor critical for cell fate determination and terminal differentiation. It plays a pivotal role in B cell development, driving mature B cells into antibody-secreting plasma cells while repressing B cell identity genes. Beyond immunity, PRDM1 regulates differentiation in other lineages, such as T cells and epithelial cells, and acts as a tumor suppressor in multiple cancers by inhibiting cell proliferation and inducing apoptosis. Dysregulation of PRDM1 is linked to lymphoid malignancies (e.g., multiple myeloma, diffuse large B-cell lymphoma) and solid tumors. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|