Mouse TL1A/TNFSF15 Protein, His tag,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Mouse
Synonyms	Tumor necrosis factor ligand superfamily member 15, TNF ligand-related molecule 1, Vascular endothelial cell growth inhibitor, Tl1, Vegi
Accession	Q5UBV8
Amino Acid Sequence	Protein sequence (Q5UBV8, Ile76-Leu252, with N-His tag) ITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL
Expression System	HEK293
Molecular Weight	Predicted MW: 21.6 kDa Observed MW: 25-30 kDa
Purity	锛?5% by SDS-PAGE
Endotoxin	<0.1EU/渭g
Conjugation	Unconjugated
Tag	with N-His tag
Physical Appearance	Lyophilized Powder
Storage Buffer	Lyophilized from a 0.2 渭m filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 to -70 掳C as supplied. 6 months, -20 to -70 掳C under sterile conditions after reconstitution. 1 week, 2 to 8 掳C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Tnfsf15, also known as tumor necrosis factor - like weak inducer of apoptosis (TWEAK), is a member of the tumor necrosis factor (TNF) superfamily. It is a type II transmembrane protein that can be cleaved to release a soluble form. Tnfsf15 plays important roles in various physiological and pathological processes. It regulates cell survival, proliferation, and migration by binding to its receptor, Fn14. In the immune system, Tnfsf15 is involved in inflammation and immune cell activation. It also participates in tissue remodeling and angiogenesis. Dysregulation of Tnfsf15 has been associated with several diseases, including cancer, autoimmune diseases, and cardiovascular diseases.