Product Specification| Species | Human | | Synonyms | Urokinase-type plasminogen activator, U-plasminogen activator, uPA, PLAU | | Accession | P00749 | | Amino Acid Sequence | Protein sequence (P00749, Ser21-Leu431, with C-His tag)
SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL | | Expression System | HEK293 | | Molecular Weight | Predicted MW: 48.1 kDa
Observed MW: 54 kDa | | Purity | 锛?5% by SDS-PAGE | | Endotoxin | <0.1EU/渭g | | Conjugation | Unconjugated | | Tag | with C-His tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | Lyophilized from a 0.2 渭m filtered solution of 0.2M PBS, pH7.4 with 3% trehalose. | | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage | 12 months from date of receipt, -20 to -70 掳C as supplied. 6 months, -20 to -70 掳C under sterile conditions after reconstitution. 1 week, 2 to 8 掳C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
BackgroundUrokinase - type plasminogen activator is a serine protease that plays a crucial role in the fibrinolytic system. It is mainly produced and secreted by various cells, such as endothelial cells and monocytes. u - PA specifically converts plasminogen into plasmin, which is capable of degrading fibrin clots and extracellular matrix proteins. This process is essential for maintaining the balance of blood coagulation and fibrinolysis, as well as for tissue remodeling and wound healing. Dysregulation of u - PA has been implicated in many pathological conditions, including thrombosis, cancer metastasis, and inflammatory diseases. Therefore, u - PA is an important target for the development of drugs to treat these diseases. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|