Human CCL20 Protein, hFc tag,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	C-C motif chemokine 2, Beta-chemokine exodus-1, CC chemokine LARC, Liver and activation-regulated chemokine, Macrophage inflammatory protein 3 alpha (MIP-3-alpha), Small-inducible cytokine A20, LARC, MIP3A, SCYA20
Accession	P78556
Amino Acid Sequence	Protein sequence (P78556, Ala27-Met96, with N-hFc tag) ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
Expression System	HEK293
Molecular Weight	Predicted MW: 35 kDa Observed MW: 35 kDa
Purity	锛?5% by SDS-PAGE
Endotoxin	<0.1EU/渭g
Conjugation	Unconjugated
Tag	with N-hFc tag
Physical Appearance	Lyophilized Powder
Storage Buffer	Lyophilized from a 0.2 渭m filtered solution of 0.2M PBS, pH7.4.
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 to -70 掳C as supplied. 6 months, -20 to -70 掳C under sterile conditions after reconstitution. 1 week, 2 to 8 掳C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CCL20, also known as macrophage inflammatory protein 3-alpha (MIP-3伪), is a small cytokine belonging to the CC chemokine family. It plays a crucial role in the immune system. CCL20 is mainly produced by activated macrophages, dendritic cells, and epithelial cells in response to various stimuli such as inflammatory cytokines and microbial products. This protein exerts its function by binding to its specific receptor CCR6. The CCL20-CCR6 axis is involved in the recruitment of immune cells to the sites of inflammation, thereby contributing to both innate and adaptive immune responses. Dysregulation of CCL20 has been associated with several diseases, including autoimmune disorders and certain types of cancers, making it a potential therapeutic target for drug development.