Product SpecificationSpecies | Human | Synonyms | Cadherin EGF LAG seven-pass G-type receptor 3, Cadherin family member 11, Epidermal growth factor-like protein 1 (EGF-like protein 1), Flamingo homolog 1 (hFmi1), Multiple epidermal growth factor-like domains protein 2 (Multiple EGF-like domains protein 2), CDHF11, EGFL1, FMI1, KIAA0812, MEGF2 | Accession | Q9NYQ7 | Amino Acid Sequence | Protein sequence (Q9NYQ7, Arg71-His180, with C-His tag)
REDGGPGLGVREPIFVGLRGRRQSARNSRGPPEQPNEELGIEHGVQPLGSRERETGQGPGSVLYWRPEVSSCGRTGPLQRGSLSPGALSSGVPGSGNSSPLPSDFLIRHH | Expression System | HEK293 | Molecular Weight | Predicted MW: 13.3 kDa
Observed MW: 17 kDa | Purity | 锛?5% by SDS-PAGE | Endotoxin | <0.1EU/渭g | Conjugation | Unconjugated | Tag | with C-His tag | Physical Appearance | Lyophilized Powder | Storage Buffer | Lyophilized from a 0.2 渭m filtered solution of 0.2M PBS, pH7.4. | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | Stability & Storage | 12 months from date of receipt, -20 to -70 掳C as supplied. 6 months, -20 to -70 掳C under sterile conditions after reconstitution. 1 week, 2 to 8 掳C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
BackgroundCadherin EGF LAG seven-pass G-type receptor 3 is a member of the flamingo subfamily, part of the cadherin superfamily. The flamingo subfamily consists of nonclassic-type cadherins; a subpopulation that does not interact with catenins. The flamingo cadherins are located at the plasma membrane and have nine cadherin domains, seven epidermal growth factor-like repeats and two laminin A G-type repeats in their ectodomain. They also have seven transmembrane domains, a characteristic unique to this subfamily. It is postulated that these proteins are receptors involved in contact-mediated communication, with cadherin domains acting as homophilic binding regions and the EGF-like domains involved in cell adhesion and receptor-ligand interactions. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|