Product SpecificationSpecies | Human | Synonyms | Prostate stem cell antigen | Accession | O43653 | Amino Acid Sequence | Protein sequence (O43653, Leu12-Ser86, with C-hFc tag)
LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS | Expression System | HEK293 | Molecular Weight | Predicted MW: 34.3 kDa
Observed MW: 43-55 kDa | Purity | >95% by SDS-PAGE | Endotoxin | <0.1EU/μg | Conjugation | Unconjugated | Tag | with C-hFc tag | Physical Appearance | Lyophilized Powder | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
BackgroundProstate stem cell antigen is a glycosylphosphatidylinositol-anchored cell membrane glycoprotein. In addition to being highly expressed in the prostate it is also expressed in the bladder, placenta, colon, kidney, and stomach. It is up-regulated in a large proportion of prostate cancers and is also detected in cancers of the bladder and pancreas. The ligand activating PSCA or the downstream physiological role has not yet been determined, because of its mechanism and over expression in prostate cancer cells, PSCA can potentially serve as a biomarker for detecting cancer. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|