Mouse Soluble IL2R alpha/CD25 Protein, His Tag,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Mouse
Synonyms	Interleukin-2 receptor subunit alpha, IL-2 receptor subunit alpha, IL-2-RA, IL-2R subunit alpha, IL2-RA, p55, CD25, Il2ra, Il2r
Accession	P01590
Amino Acid Sequence	Protein sequence (P01590, Glu22-Lys236, with C-His Tag) ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYK
Expression System	HEK293
Molecular Weight	Predicted MW: 26.4 kDa Observed MW: 45-70 kDa
Purity	＞95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Physical Appearance	Lyophilized Powder
Storage Buffer	Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The interleukin-2 receptor alpha chain (also called Tac antigen, P55, and mainly CD25) is a protein involved in the assembly of the high-affinity interleukin-2 receptor, consisting of alpha (IL2RA), beta (IL2RB) and the common gamma chain (IL2RG). This receptor interacts with interleukin-2, a pleiotropic cytokine which plays an important role in immune homeostasis. Quantification of soluble IL2RA is a useful and simple tool for clinicians to assess immune function in vivo as part of the investigation, management, and prognosis of a broad spectrum of diseases, such as sarcoidosis, Multiple Sclerosis, primary biliary cirrhosis, Chronic immune activation in common variable immunodeficiency (CVID), chronic liver diseases and many more.