Human CCL4 Protein, hFc tag,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	C-C motif chemokine 4, G-26 T-lymphocyte-secreted protein, HC21, Lymphocyte activation gene 1 protein (LAG-1), MIP-1-beta (1-69), Macrophage inflammatory protein 1-beta (MIP-1-beta), PAT 744, Protein H400, SIS-gamma, Small-inducible cytokine A4, T-cell activation protein 2 (ACT-2), LAG1, MIP1B, SCYA4
Accession	P13236
Amino Acid Sequence	Protein sequence (P13236, Ala24-Asn92, with C-hFc tag) APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
Expression System	HEK293
Molecular Weight	Predicted MW: 33.9 kDa Observed MW: 40 kDa
Purity	＞95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	with C-hFc tag
Physical Appearance	Lyophilized Powder
Storage Buffer	Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CCL4 is a small cytokine that belongs to the CC chemokine subfamily. CCL4 is being secreted under mitogenic signals and antigens and hereby acts as a chemoattractant for natural killer cells, monocytes and various other immune cells in the site of inflamed or damaged tissue. CCL4 is produced by: monocytes, B cells, T cells, NK cells, dendritic cells, neutrophils, fibroblasts, endothelial cells such as vascular smooth muscle cells, brain microvessel endothelial cells, fetal microglia and epithelial cells. CCL4 is a major HIV-suppressive factor produced by CD8+ T cells.