|
Human ALPI Protein, His tag
Origin of place |
Singapore  |
Model |
S0A0145-25μg |
Supplier |
ANT BIO PTE.LTD. |
Price |
170 |
Hits |
32 |
Updated |
9/1/2025 |
|
Product SpecificationSpecies | Human | Synonyms | Intestinal-type alkaline phosphatase, IAP, Intestinal alkaline phosphatase | Accession | P09923 | Amino Acid Sequence | Protein sequence (P09923, Val20-Asp503, with C-His tag)
VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPACTTD | Expression System | HEK293 | Molecular Weight | Predicted MW: 54.1 kDa
Observed MW: 65-75 kDa | Purity | >95% by SDS-PAGE | Endotoxin | <0.1EU/μg | Conjugation | Unconjugated | Tag | with C-His tag | Physical Appearance | Lyophilized Powder | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
BackgroundAlkaline phosphatase, intestinal also known as ALPI is a type of alkaline phosphatase that in humans is encoded by the ALPI gene. Intestinal alkaline phosphatase is an endogenous protein that plays an essential function in the maintenance of gut homeostasis. The protein is responsible for detoxifying bacterial toxins, dephosphorylating phosphorylated nucleotides, regulating lipid absorption in the intestine, and regulating the microbiome in the intestine. In addition to these functions, intestinal alkaline phosphatase can also modulate bicarbonate secretion and can modulate the pH of the duodenum. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|