Mouse CD3 epsilon Protein, hFc tag,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Mouse
Synonyms	T-cell surface glycoprotein CD3 epsilon chain, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, Cd3e
Accession	P22646
Amino Acid Sequence	Protein sequence (P22646, Asp23-Asp108, with C-hFc tag) DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD
Expression System	HEK293
Molecular Weight	Predicted MW: 36 kDa Observed MW: 43 kDa
Purity	＞95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	with C-hFc tag
Physical Appearance	Lyophilized Powder
Storage Buffer	Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD3e molecule, epsilon also known as CD3E. The protein is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause severe immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women. T-cell surface glycoprotein CD3 epsilon chain has been shown to interact with TOP2B, CD3EAP and NCK2.