Human CCL22 Protein, hFc tag,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	C-C motif chemokine 22, CC chemokine STCP-1, MDC (1-69), Macrophage-derived chemokine, Small-inducible cytokine A22, Stimulated T-cell chemotactic protein 1, MDC, SCYA22
Accession	O00626
Amino Acid Sequence	Protein sequence (O00626, Gly25-Gln93, with C-hFc tag) GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ
Expression System	HEK293
Molecular Weight	Predicted MW: 34.2 kDa Observed MW: 40 kDa
Purity	＞95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	with C-hFc tag
Physical Appearance	Lyophilized Powder
Storage Buffer	Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

C-C motif chemokine 22 is a protein that in humans is encoded by the CCL22 gene. The protein encoded by this gene is secreted by dendritic cells and macrophages, and elicits its effects on its target cells by interacting with cell surface chemokine receptors such as CCR4. The gene for CCL22 is located in human chromosome 16 in a cluster with other chemokines called CX3CL1 and CCL17. Involved in antimicrobial humoral immune response mediated by antimicrobial peptide. It is biomarker of several diseases, including arthritis (multiple), cervical squamous cell carcinoma, lung disease (multiple), pleural tuberculosis and rhinitis.