|
Human Serpin A10 Protein, His tag
| Origin of place |
Singapore  |
| Model |
S0A0128-25μg |
| Supplier |
ANT BIO PTE.LTD. |
| Price |
235 |
| Hits |
78 |
| Updated |
12/2/2025 |
|
Product Specification| Species | Human | | Synonyms | Protein Z-dependent protease inhibitor, PZ-dependent protease inhibitor, PZI, SERPINA10, ZPI | | Accession | Q9UK55 | | Amino Acid Sequence | Protein sequence (Q9UK55, Leu22-Leu444, with C-His tag)
LAPSPQSPETPAPQNQTSRVVQAPKEEEEDEQEASEEKASEEEKAWLMASRQQLAKETSNFGFSLLRKISMRHDGNMVFSPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGLLPSLFKGLRETLSRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYINKETRGKIPKLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTIKVPMMYGAGKFASTFDKNFRCHVLKLPYQGNATMLVVLMEKMGDHLALEDYLTTDLVETWLRNMKTRNMEVFFPKFKLDQKYEMHELLRQMGIRRIFSPFADLSELSATGRNLQVSRVLQRTVIEVDERGTEAVAGILSEITAYSMPPVIKVDRPFHFMIYEETSGMLLFLGRVVNPTLL | | Expression System | HEK293 | | Molecular Weight | Predicted MW: 50.1 kDa
Observed MW: 72 kDa | | Purity | >95% by SDS-PAGE | | Endotoxin | <0.1EU/μg | | Conjugation | Unconjugated | | Tag | with C-His tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. | | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
BackgroundProtein Z-dependent protease inhibitor (ZPI) is a protein circulating in the blood which inhibits factors Xa and XIa of the coagulation cascade. Inhibits activity of the coagulation protease factor Xa in the presence of PROZ, calcium and phospholipids. Also inhibits factor XIa in the absence of cofactors. Heparin acts as an important cofactor, producing 20 to 100-fold accelerations of SERPINA10 reactions with factor Xa and factor XIa. It is a member of the class of the serine protease inhibitors (serpins). Its name implies that it requires protein Z, another circulating protein, to function properly, but this only applies to its inhibition of factor X. It is about 72 kDa heavy and 444 amino acids large. It is produced by the liver. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|