Product SpecificationSpecies | Mouse | Synonyms | Leukosialin, B-cell differentiation antigen LP-3, Leukocyte sialoglycoprotein, Lymphocyte antigen 48 (Ly-48), Sialophorin, Spn | Accession | P15702 | Amino Acid Sequence | Protein sequence (P15702, Asp20-Pro253, with C-His tag)
DSLQRTTMLPSTPHITAPSTSEAQNASPSVSVGSGTVDSKETISPWGQTTIPVSLTPLETTELSSLETSAGASMSTPVPEPTASQEVSSKTSALLPEPSNVASDPPVTAANPVTDGPAANPVTDGTAASTSISKGTSAPPTTVTTSSNETSGPSVATTVSSKTSGPPVTTATGSLGPSSEMHGLPATTATSSVESSSVARGTSVSSRKTSTTSTQDPITTRSPSQESSGMLLVP | Expression System | HEK293 | Molecular Weight | Predicted MW: 24.8 kDa
Observed MW: 50-95 kDa | Purity | >95% by SDS-PAGE | Endotoxin | <0.1EU/μg | Conjugation | Unconjugated | Tag | with C-His tag | Physical Appearance | Lyophilized Powder | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
BackgroundLeukosialin also known as sialophorin or CD43 (cluster of differentiation 43) is a transmembrane cell surface protein. Sialophorin (leukosialin) is a major sialoglycoprotein on the surface of human T lymphocytes, monocytes, granulocytes, and some B lymphocytes, which appears to be important for immune function and may be part of a physiologic ligand-receptor complex involved in T-cell activation. Defects in the CD43 molecule are associated with the development of Wiskott–Aldrich syndrome. It also appears in about 25% of intestinal MALTomas. Using immunohistochemistry, CD43 can be demonstrated in the paracortical T-cells of healthy lymph nodes and tonsils; it is also positive in a range of lymphoid and myeloid tumours. Because it stains granulocytes and their precursors, it is an effective marker for myeloid tumours. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|