Mouse GR-1 (Ly-6G), His tag,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Mouse
Synonyms	Lymphocyte antigen 6G, Ly-6G.1
Accession	P35461
Amino Acid Sequence	Protein sequence (P35461, Leu27-Asn105, with C-10*His) LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNGGGGSHHHHHHHHHH
Expression System	HEK293
Molecular Weight	Predicted MW: 10.3 kDa Observed MW: 11, 17-19 kDa
Purity	＞95% by SDS-PAGE
Endotoxin	<1EU/μg
Tag	with C-10*His
Physical Appearance	Lyophilized Powder
Storage Buffer	Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Lymphocyte antigen 6G (Ly6G) is a 21-25 kDa glycosyolphosphatidylinositol-anchored protein that is predominatly expressed in granulocytes in bone marrow. Ly6G is a member of the so called Ly6/uPAR family of GPI-anchored surface proteins. Only encoded in mice, Ly6G shows structural and functional similarities to another Ly6/uPAR family member, CD177, which is expressed specifically on both human and mouse neutrophils. Ly6G is a homolog of the human CD177 protein, which has been shown to interact with cell adhesion molecules, and serves as a bona fide marker for neutrophils in mice. Ly6G contributes to the early engagement of intracellular pathogens by the immune system.