|
Human Parvalbumin, His tag
Origin of place |
Singapore  |
Model |
S0A0089-10μg |
Supplier |
ANT BIO PTE.LTD. |
Price |
110 |
Hits |
0 |
Updated |
8/25/2025 |
|
Product SpecificationSpecies | Human | Synonyms | PVALB | Accession | P20472 | Amino Acid Sequence | Protein sequence (P20472, Met1-Ser110, with C-10*His)
MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAESGGGGSHHHHHHHHHH | Expression System | E.coli | Molecular Weight | Predicted MW: 13.7 kDa
Observed MW: 13.7 kDa | Purity | >95% by SDS-PAGE | Endotoxin | <1EU/μg | Tag | with C-10*His | Physical Appearance | Lyophilized Powder | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles. |
BackgroundParvalbumin (PV) is a calcium-binding protein with low molecular weight. It is encoded by the PVALB gene. It has three EF hand motifs and is structurally related to calmodulin and troponin C. Parvalbumin is found in fast-contracting muscles, where its levels are highest, as well as in the brain and some endocrine tissues. Calcium binding proteins like parvalbumin play a role in many physiological processes, namely cell-cycle regulation, second messenger production, muscle contraction, organization of microtubules and phototransduction. Decreased PV and GAD67 expression was found in PV+ GABAergic interneurons in schizophrenia. Parvalbumin has been identified as an allergen causing fish allergy (but not shellfish allergy). Bony fishes manifest β-parvalbumin and cartilaginous fishes such as sharks and rays manifest α-parvalbumin; allergenicity to bony fishes has a low cross-reactivity to cartilaginous fishes. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|