Product SpecificationSpecies | Human | Synonyms | MOX1, MOX2 | Accession | P41217 | Amino Acid Sequence | Protein sequence (P41217, Gln31-Gly232, with C-10*His)
QVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKGGGGGSHHHHHHHHHH | Expression System | CHO | Molecular Weight | Predicted MW: 24.1 kDa
Observed MW: 35-50 kDa | Purity | >95% by SDS-PAGE | Tag | with C-10*His | Physical Appearance | Lyophilized Powder | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles. |
BackgroundOX-2 membrane glycoprotein, also named CD200 (Cluster of Differentiation 200) is a human protein encoded by the CD200 gene. CD 200 belongs to the immunoglobulin superfamily, particularly belongs to the B7 receptor family. CD200 is overexpressed in cancer cells in a number of human tumors including melanoma, ovarian cancer, some B-cell malignances and small cell lung carcinoma. In the tumor microenvironment CD200 is also expressed in endothelial cells and activated T lymphocytes, B lymhocytes and myeloid cells. These cells can thus interact with cells expressing CD200R such as T regulatory cells, tumor-associated dendritic cells, tumor associated macrophages and myeloid derived suppressor cells (MDSC). It was shown that CD200 expressed on tumor cells promotes expansion of MDSCs that are capable of inhibiting anti-tumor immune response. CD200 blockade inhibits tumor growth and decreases number of MDSCs in tumor tissue. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|